Total number of results for Scyliorhinus canicula are 9
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02012 |
GWTNLSAGYLLGPHAVDNHRSLNDKHGLA
|
29 | Scyliorhinus canicula | Galanin | Galanin | 7527531#Wang Y, Conlon JM#Purification and characterization of galanin from the phylogenetically ancient fish, the bowfin (Amia calva) and dogfish (Scyliorhinus canicula)#Peptides 1994;15(6):981-6 | |
| NP02287 |
HSDAVFTDNYSRIRKQMAVKKYINSLLA
|
28 | Scyliorhinus canicula | Glucagon | vasoactive intestinal peptide | 2441759#Dimaline R, Young J, Thwaites DT, Lee CM, Shuttleworth TJ, Thorndyke MC#A novel vasoactive intestinal peptide (VIP) from elasmobranch intestine has full affinity for mammalian pancreatic VIP receptors#Biochim Biophys Acta 1987 Aug 19;930(1):97-100 $#Dimaline R., Young J., Thwaites D.T., Lee C.M., Thorndyke M.C.#Amino acid sequence of a biologically active vasoactive intestinal peptide from the elasmobranch Scyliorhinus canicula.#Ann. N. Y. Acad. Sci. 527:621-623(1988). | |
| NP03800 |
YPSKPDNPGEGAPAEDLAKYYSALRHYINLITRQRY
|
36 | Scyliorhinus canicula | NPY | Pancreatic polypeptide | 1523163#Conlon JM, Bjenning C, Hazon N#Structural characterization of neuropeptide Y from the brain of the dogfish, Scyliorhinus canicula#Peptides 1992 May-Jun;13(3):493-7 | |
| NP03934 |
YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY
|
36 | Scyliorhinus canicula | NPY | Pancreatic polypeptide | 2019251#Conlon JM, Balasubramaniam A, Hazon N#Structural characterization and biological activity of a neuropeptide Y-related peptide from the dogfish, Scyliorhinus canicula#Endocrinology 1991 May;128(5):2273-9 | |
| NP05228 |
PAETPNSLDLTFHLLREMIEIAKHENQQMQADSNRRIMDTI
|
41 | Scyliorhinus canicula | Sauvagine/corticotropin-releasing factor/urotensin I | Corticotropin-releasing hormone | 8536945#Waugh D, Anderson G, Armour KJ, Balment RJ, Hazon N, Conlon JM#A peptide from the caudal neurosecretory system of the dogfish Scyliorhinus canicula that is structurally related to urotensin I#Gen Comp Endocrinol 1995 Sep;99(3):333-9 | |
| NP05777 |
AKFDKFYGLM
|
10 | Scyliorhinus canicula | Tachykinin | Scyliorhinin-1 | 2422058#Conlon J.M., Deacon C.F., O'Toole L., Thim L.; #Scyliorhinin I and II: two novel tachykinins from dogfish gut.; #FEBS Lett. 200:111-116(1986).$7685693#Waugh D., Wang Y., Hazon N., Balment R.J., Conlon J.M.; #Primary structures and biological activities of substance-P-related peptides from the brain of the dogfish, Scyliorhinus canicula.; #Eur. J. Biochem. 214:469-474(1993). | |
| NP05778 |
SPSNSKCPDGPDCFVGLM
|
18 | Scyliorhinus canicula | Tachykinin | Scyliorhinin-2 | 2422058#Conlon J.M., Deacon C.F., O'Toole L., Thim L.; #Scyliorhinin I and II: two novel tachykinins from dogfish gut.; #FEBS Lett. 200:111-116(1986).$7541963#Anderson W.G., Conlon J.M., Hazon N.; #"Characterization of the endogenous intestinal peptide that stimulates the rectal gland of Scyliorhinus canicula."; #Am. J. Physiol. 268:R1359-R1364(1995). | |
| NP05779 |
KPRPGQFFGLM
|
11 | Scyliorhinus canicula | Tachykinin | Substance P | 7685693#Waugh D., Wang Y., Hazon N., Balment R.J., Conlon J.M.; #Primary structures and biological activities of substance-P-related peptides from the brain of the dogfish, Scyliorhinus canicula.; #Eur. J. Biochem. 214:469-474(1993). | |
| NP05808 |
NNFSDCFWKYCV
|
12 | Scyliorhinus canicula | Urotensin-2 | Urotensin II | 1620290#Conlon JM, O'Harte F, Smith DD, Balment RJ, Hazon N#Purification and characterization of urotensin II and parvalbumin from an elasmobranch fish, Scyliorhinus canicula (common dogfish)#Neuroendocrinology 1992 Feb;55(2):230-5 |